GTPBP1 monoclonal antibody (M01), clone 1H1
  • GTPBP1 monoclonal antibody (M01), clone 1H1

GTPBP1 monoclonal antibody (M01), clone 1H1

Ref: AB-H00009567-M01
GTPBP1 monoclonal antibody (M01), clone 1H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GTPBP1.
Información adicional
Size 100 ug
Gene Name GTPBP1
Gene Alias GP-1|GP1|HSPC018|MGC20069
Gene Description GTP binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9567
Clone Number 1H1
Iso type IgG2a Kappa

Enviar uma mensagem


GTPBP1 monoclonal antibody (M01), clone 1H1

GTPBP1 monoclonal antibody (M01), clone 1H1