GTPBP1 MaxPab mouse polyclonal antibody (B01P)
  • GTPBP1 MaxPab mouse polyclonal antibody (B01P)

GTPBP1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009567-B01P
GTPBP1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTPBP1 protein.
Información adicional
Size 50 ug
Gene Name GTPBP1
Gene Alias GP-1|GP1|HSPC018|MGC20069
Gene Description GTP binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTPBP1 (ENSP00000334787, 1 a.a. ~ 584 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9567

Enviar uma mensagem


GTPBP1 MaxPab mouse polyclonal antibody (B01P)

GTPBP1 MaxPab mouse polyclonal antibody (B01P)