RAB3D polyclonal antibody (A01)
  • RAB3D polyclonal antibody (A01)

RAB3D polyclonal antibody (A01)

Ref: AB-H00009545-A01
RAB3D polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant RAB3D.
Información adicional
Size 50 uL
Gene Name RAB3D
Gene Alias D2-2|GOV|RAB16|RAD3D
Gene Description RAB3D, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB3D (AAH16471, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9545

Enviar uma mensagem


RAB3D polyclonal antibody (A01)

RAB3D polyclonal antibody (A01)