NRG2 polyclonal antibody (A01)
  • NRG2 polyclonal antibody (A01)

NRG2 polyclonal antibody (A01)

Ref: AB-H00009542-A01
NRG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRG2.
Información adicional
Size 50 uL
Gene Name NRG2
Gene Alias Don-1|HRG2|NTAK
Gene Description neuregulin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRG2 (NP_004874, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9542

Enviar uma mensagem


NRG2 polyclonal antibody (A01)

NRG2 polyclonal antibody (A01)