CIR monoclonal antibody (M01), clone 2E11
  • CIR monoclonal antibody (M01), clone 2E11

CIR monoclonal antibody (M01), clone 2E11

Ref: AB-H00009541-M01
CIR monoclonal antibody (M01), clone 2E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CIR.
Información adicional
Size 100 ug
Gene Name CIR
Gene Alias -
Gene Description CBF1 interacting corepressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIR (NP_004873, 136 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9541
Clone Number 2E11
Iso type IgG1 Kappa

Enviar uma mensagem


CIR monoclonal antibody (M01), clone 2E11

CIR monoclonal antibody (M01), clone 2E11