CIR polyclonal antibody (A01)
  • CIR polyclonal antibody (A01)

CIR polyclonal antibody (A01)

Ref: AB-H00009541-A01
CIR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CIR.
Información adicional
Size 50 uL
Gene Name CIR
Gene Alias -
Gene Description CBF1 interacting corepressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIR (NP_004873, 136 a.a. ~ 204 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9541

Enviar uma mensagem


CIR polyclonal antibody (A01)

CIR polyclonal antibody (A01)