TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)
  • TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)

TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009540-D01P
TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TP53I3 protein.
Información adicional
Size 100 ug
Gene Name TP53I3
Gene Alias PIG3
Gene Description tumor protein p53 inducible protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TP53I3 (NP_004872.2, 1 a.a. ~ 332 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9540

Enviar uma mensagem


TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)

TP53I3 purified MaxPab rabbit polyclonal antibody (D01P)