PTGES monoclonal antibody (M04A), clone 2B9
  • PTGES monoclonal antibody (M04A), clone 2B9

PTGES monoclonal antibody (M04A), clone 2B9

Ref: AB-H00009536-M04A
PTGES monoclonal antibody (M04A), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PTGES.
Información adicional
Size 200 uL
Gene Name PTGES
Gene Alias MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene Description prostaglandin E synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9536
Clone Number 2B9
Iso type IgG2b Kappa

Enviar uma mensagem


PTGES monoclonal antibody (M04A), clone 2B9

PTGES monoclonal antibody (M04A), clone 2B9