PTGES purified MaxPab rabbit polyclonal antibody (D01P)
  • PTGES purified MaxPab rabbit polyclonal antibody (D01P)

PTGES purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009536-D01P
PTGES purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTGES protein.
Información adicional
Size 100 ug
Gene Name PTGES
Gene Alias MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene Description prostaglandin E synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTGES (NP_004869.1, 1 a.a. ~ 152 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9536

Enviar uma mensagem


PTGES purified MaxPab rabbit polyclonal antibody (D01P)

PTGES purified MaxPab rabbit polyclonal antibody (D01P)