BAG4 MaxPab rabbit polyclonal antibody (D01)
  • BAG4 MaxPab rabbit polyclonal antibody (D01)

BAG4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009530-D01
BAG4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BAG4 protein.
Información adicional
Size 100 uL
Gene Name BAG4
Gene Alias BAG-4|SODD
Gene Description BCL2-associated athanogene 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BAG4 (NP_004865.1, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9530

Enviar uma mensagem


BAG4 MaxPab rabbit polyclonal antibody (D01)

BAG4 MaxPab rabbit polyclonal antibody (D01)