EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)
  • EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)

EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009521-B01P
EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EEF1E1 protein.
Información adicional
Size 50 ug
Gene Name EEF1E1
Gene Alias AIMP3|P18
Gene Description eukaryotic translation elongation factor 1 epsilon 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EEF1E1 (NP_004271.1, 1 a.a. ~ 174 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9521

Enviar uma mensagem


EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)

EEF1E1 purified MaxPab mouse polyclonal antibody (B01P)