SPTLC2 polyclonal antibody (A01)
  • SPTLC2 polyclonal antibody (A01)

SPTLC2 polyclonal antibody (A01)

Ref: AB-H00009517-A01
SPTLC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPTLC2.
Información adicional
Size 50 uL
Gene Name SPTLC2
Gene Alias KIAA0526|LCB2|SPT2
Gene Description serine palmitoyltransferase, long chain base subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPTLC2 (NP_004854, 453 a.a. ~ 561 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9517

Enviar uma mensagem


SPTLC2 polyclonal antibody (A01)

SPTLC2 polyclonal antibody (A01)