Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ADAMTS1 monoclonal antibody (M01), clone 2A9
Abnova
ADAMTS1 monoclonal antibody (M01), clone 2A9
Ref: AB-H00009510-M01
ADAMTS1 monoclonal antibody (M01), clone 2A9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ADAMTS1.
Información adicional
Size
50 ug
Gene Name
ADAMTS1
Gene Alias
C3-C5|KIAA1346|METH1
Gene Description
ADAM metallopeptidase with thrombospondin type 1 motif, 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ADAMTS1 (AAH36515, 858 a.a. ~ 967 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9510
Clone Number
2A9
Iso type
IgG1 Kappa
Enviar uma mensagem
ADAMTS1 monoclonal antibody (M01), clone 2A9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*