Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ADAMTS3 monoclonal antibody (M10), clone 1H8
Abnova
ADAMTS3 monoclonal antibody (M10), clone 1H8
Ref: AB-H00009508-M10
ADAMTS3 monoclonal antibody (M10), clone 1H8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ADAMTS3.
Información adicional
Size
100 ug
Gene Name
ADAMTS3
Gene Alias
ADAMTS-4|KIAA0366
Gene Description
ADAM metallopeptidase with thrombospondin type 1 motif, 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9508
Clone Number
1H8
Iso type
IgG1 Kappa
Enviar uma mensagem
ADAMTS3 monoclonal antibody (M10), clone 1H8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*