Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AKAP5 monoclonal antibody (M04), clone 1A9
Abnova
AKAP5 monoclonal antibody (M04), clone 1A9
Ref: AB-H00009495-M04
AKAP5 monoclonal antibody (M04), clone 1A9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant AKAP5.
Información adicional
Size
100 ug
Gene Name
AKAP5
Gene Alias
AKAP75|AKAP79|H21
Gene Description
A kinase (PRKA) anchor protein 5
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
RMEPIAIIITDTEISEFDVTKSKNVPKQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKINNLLQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AKAP5 (NP_004848.2, 334 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9495
Clone Number
1A9
Iso type
IgG2a Kappa
Enviar uma mensagem
AKAP5 monoclonal antibody (M04), clone 1A9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*