SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009481-B01P
SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC25A27 protein.
Información adicional
Size 50 ug
Gene Name SLC25A27
Gene Alias FLJ33552|UCP4
Gene Description solute carrier family 25, member 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC25A27 (AAH33091, 1 a.a. ~ 245 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9481

Enviar uma mensagem


SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)

SLC25A27 purified MaxPab mouse polyclonal antibody (B01P)