MED20 purified MaxPab mouse polyclonal antibody (B01P)
  • MED20 purified MaxPab mouse polyclonal antibody (B01P)

MED20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009477-B01P
MED20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MED20 protein.
Información adicional
Size 50 ug
Gene Name MED20
Gene Alias DKFZp586D2223|MGC29869|PRO0213|TRFP
Gene Description mediator complex subunit 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MED20 (NP_004266.2, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9477

Enviar uma mensagem


MED20 purified MaxPab mouse polyclonal antibody (B01P)

MED20 purified MaxPab mouse polyclonal antibody (B01P)