C1orf38 purified MaxPab mouse polyclonal antibody (B01P)
  • C1orf38 purified MaxPab mouse polyclonal antibody (B01P)

C1orf38 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009473-B01P
C1orf38 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1orf38 protein.
Información adicional
Size 50 ug
Gene Name C1orf38
Gene Alias ICB-1
Gene Description chromosome 1 open reading frame 38
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHSELPGQMDARCWGRERGLPLGAALMEDTPTPSLRISWNFRLLPLYYTEVILFF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1orf38 (AAH81568.1, 1 a.a. ~ 132 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9473

Enviar uma mensagem


C1orf38 purified MaxPab mouse polyclonal antibody (B01P)

C1orf38 purified MaxPab mouse polyclonal antibody (B01P)