EIF4E2 MaxPab mouse polyclonal antibody (B01P)
  • EIF4E2 MaxPab mouse polyclonal antibody (B01P)

EIF4E2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009470-B01P
EIF4E2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.
Información adicional
Size 50 ug
Gene Name EIF4E2
Gene Alias 4E-LP|4EHP|EIF4EL3|IF4e
Gene Description eukaryotic translation initiation factor 4E family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF4E2 (AAH21690.1, 1 a.a. ~ 245 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9470

Enviar uma mensagem


EIF4E2 MaxPab mouse polyclonal antibody (B01P)

EIF4E2 MaxPab mouse polyclonal antibody (B01P)