EIF4E2 polyclonal antibody (A01)
  • EIF4E2 polyclonal antibody (A01)

EIF4E2 polyclonal antibody (A01)

Ref: AB-H00009470-A01
EIF4E2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF4E2.
Información adicional
Size 50 uL
Gene Name EIF4E2
Gene Alias 4E-LP|4EHP|EIF4EL3|IF4e
Gene Description eukaryotic translation initiation factor 4E family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4E2 (NP_004837, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9470

Enviar uma mensagem


EIF4E2 polyclonal antibody (A01)

EIF4E2 polyclonal antibody (A01)