CHST3 polyclonal antibody (A01)
  • CHST3 polyclonal antibody (A01)

CHST3 polyclonal antibody (A01)

Ref: AB-H00009469-A01
CHST3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHST3.
Información adicional
Size 50 uL
Gene Name CHST3
Gene Alias C6ST|C6ST1|HSD
Gene Description carbohydrate (chondroitin 6) sulfotransferase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST3 (NP_004264, 312 a.a. ~ 411 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9469

Enviar uma mensagem


CHST3 polyclonal antibody (A01)

CHST3 polyclonal antibody (A01)