HAND2 monoclonal antibody (M01), clone 4H8
  • HAND2 monoclonal antibody (M01), clone 4H8

HAND2 monoclonal antibody (M01), clone 4H8

Ref: AB-H00009464-M01
HAND2 monoclonal antibody (M01), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HAND2.
Información adicional
Size 100 ug
Gene Name HAND2
Gene Alias DHAND2|FLJ16260|Hed|MGC125303|MGC125304|Thing2|bHLHa26|dHand
Gene Description heart and neural crest derivatives expressed 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9464
Clone Number 4H8
Iso type IgG2a Kappa

Enviar uma mensagem


HAND2 monoclonal antibody (M01), clone 4H8

HAND2 monoclonal antibody (M01), clone 4H8