MAP4K4 monoclonal antibody (M01), clone 2D4
  • MAP4K4 monoclonal antibody (M01), clone 2D4

MAP4K4 monoclonal antibody (M01), clone 2D4

Ref: AB-H00009448-M01
MAP4K4 monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
Información adicional
Size 100 ug
Gene Name MAP4K4
Gene Alias FLH21957|FLJ10410|FLJ20373|FLJ90111|HGK|KIAA0687|NIK
Gene Description mitogen-activated protein kinase kinase kinase kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9448
Clone Number 2D4
Iso type IgG2a Kappa

Enviar uma mensagem


MAP4K4 monoclonal antibody (M01), clone 2D4

MAP4K4 monoclonal antibody (M01), clone 2D4