GSTO1 monoclonal antibody (M03), clone 1B6
  • GSTO1 monoclonal antibody (M03), clone 1B6

GSTO1 monoclonal antibody (M03), clone 1B6

Ref: AB-H00009446-M03
GSTO1 monoclonal antibody (M03), clone 1B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GSTO1.
Información adicional
Size 100 ug
Gene Name GSTO1
Gene Alias DKFZp686H13163|GSTTLp28|P28
Gene Description glutathione S-transferase omega 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9446
Clone Number 1B6
Iso type IgG1 Kappa

Enviar uma mensagem


GSTO1 monoclonal antibody (M03), clone 1B6

GSTO1 monoclonal antibody (M03), clone 1B6