GSTO1 MaxPab mouse polyclonal antibody (B01)
  • GSTO1 MaxPab mouse polyclonal antibody (B01)

GSTO1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00009446-B01
GSTO1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human GSTO1 protein.
Información adicional
Size 50 uL
Gene Name GSTO1
Gene Alias DKFZp686H13163|GSTTLp28|P28
Gene Description glutathione S-transferase omega 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTO1 (NP_004823.1, 1 a.a. ~ 241 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9446

Enviar uma mensagem


GSTO1 MaxPab mouse polyclonal antibody (B01)

GSTO1 MaxPab mouse polyclonal antibody (B01)