CRSP8 monoclonal antibody (M01), clone 8B8
  • CRSP8 monoclonal antibody (M01), clone 8B8

CRSP8 monoclonal antibody (M01), clone 8B8

Ref: AB-H00009442-M01
CRSP8 monoclonal antibody (M01), clone 8B8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CRSP8.
Información adicional
Size 50 ug
Gene Name MED27
Gene Alias CRAP34|CRSP34|CRSP8|MGC11274|TRAP37
Gene Description mediator complex subunit 27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9442
Clone Number 8B8
Iso type IgG1 Kappa

Enviar uma mensagem


CRSP8 monoclonal antibody (M01), clone 8B8

CRSP8 monoclonal antibody (M01), clone 8B8