CRSP7 monoclonal antibody (M06), clone 2G10
  • CRSP7 monoclonal antibody (M06), clone 2G10

CRSP7 monoclonal antibody (M06), clone 2G10

Ref: AB-H00009441-M06
CRSP7 monoclonal antibody (M06), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRSP7.
Información adicional
Size 100 ug
Gene Name MED26
Gene Alias CRSP7|CRSP70
Gene Description mediator complex subunit 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRSP7 (NP_004822, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9441
Clone Number 2G10
Iso type IgG2a Kappa

Enviar uma mensagem


CRSP7 monoclonal antibody (M06), clone 2G10

CRSP7 monoclonal antibody (M06), clone 2G10