MED26 purified MaxPab rabbit polyclonal antibody (D01P)
  • MED26 purified MaxPab rabbit polyclonal antibody (D01P)

MED26 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009441-D01P
MED26 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MED26 protein.
Información adicional
Size 100 ug
Gene Name MED26
Gene Alias CRSP7|CRSP70
Gene Description mediator complex subunit 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGPPRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPLPTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQPKASVLQQLDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MED26 (NP_004822.2, 1 a.a. ~ 600 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9441

Enviar uma mensagem


MED26 purified MaxPab rabbit polyclonal antibody (D01P)

MED26 purified MaxPab rabbit polyclonal antibody (D01P)