CRSP6 monoclonal antibody (M01), clone 4D4
  • CRSP6 monoclonal antibody (M01), clone 4D4

CRSP6 monoclonal antibody (M01), clone 4D4

Ref: AB-H00009440-M01
CRSP6 monoclonal antibody (M01), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRSP6.
Información adicional
Size 100 ug
Gene Name MED17
Gene Alias CRSP6|CRSP77|DRIP80|FLJ10812|TRAP80
Gene Description mediator complex subunit 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9440
Clone Number 4D4
Iso type IgG1 Kappa

Enviar uma mensagem


CRSP6 monoclonal antibody (M01), clone 4D4

CRSP6 monoclonal antibody (M01), clone 4D4