CRSP3 monoclonal antibody (M01), clone 4H6
  • CRSP3 monoclonal antibody (M01), clone 4H6

CRSP3 monoclonal antibody (M01), clone 4H6

Ref: AB-H00009439-M01
CRSP3 monoclonal antibody (M01), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRSP3.
Información adicional
Size 100 ug
Gene Name MED23
Gene Alias CRSP130|CRSP133|CRSP3|DKFZp434H0117|DRIP130|SUR2
Gene Description mediator complex subunit 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRSP3 (NP_004821, 531 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9439
Clone Number 4H6
Iso type IgG2a Kappa

Enviar uma mensagem


CRSP3 monoclonal antibody (M01), clone 4H6

CRSP3 monoclonal antibody (M01), clone 4H6