CHST2 polyclonal antibody (A01)
  • CHST2 polyclonal antibody (A01)

CHST2 polyclonal antibody (A01)

Ref: AB-H00009435-A01
CHST2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CHST2.
Información adicional
Size 50 uL
Gene Name CHST2
Gene Alias C6ST|GST2
Gene Description carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST2 (NP_004258, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9435

Enviar uma mensagem


CHST2 polyclonal antibody (A01)

CHST2 polyclonal antibody (A01)