CRIPT monoclonal antibody (M03), clone 4D7
  • CRIPT monoclonal antibody (M03), clone 4D7

CRIPT monoclonal antibody (M03), clone 4D7

Ref: AB-H00009419-M03
CRIPT monoclonal antibody (M03), clone 4D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRIPT.
Información adicional
Size 100 ug
Gene Name CRIPT
Gene Alias HSPC139
Gene Description cysteine-rich PDZ-binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRIPT (NP_054890.1, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9419
Clone Number 4D7
Iso type IgG2a Kappa

Enviar uma mensagem


CRIPT monoclonal antibody (M03), clone 4D7

CRIPT monoclonal antibody (M03), clone 4D7