C9orf61 monoclonal antibody (M01), clone 1H3
  • C9orf61 monoclonal antibody (M01), clone 1H3

C9orf61 monoclonal antibody (M01), clone 1H3

Ref: AB-H00009413-M01
C9orf61 monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C9orf61.
Información adicional
Size 100 ug
Gene Name C9orf61
Gene Alias MGC142243|MGC142245|RP11-548B3.1|X123
Gene Description chromosome 9 open reading frame 61
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QIMAPLQPSTSRAHRLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C9orf61 (NP_004807, 383 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9413
Clone Number 1H3
Iso type IgG2a Kappa

Enviar uma mensagem


C9orf61 monoclonal antibody (M01), clone 1H3

C9orf61 monoclonal antibody (M01), clone 1H3