ARHGAP29 polyclonal antibody (A01)
  • ARHGAP29 polyclonal antibody (A01)

ARHGAP29 polyclonal antibody (A01)

Ref: AB-H00009411-A01
ARHGAP29 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGAP29.
Información adicional
Size 50 uL
Gene Name ARHGAP29
Gene Alias PARG1|RP11-255E17.1
Gene Description Rho GTPase activating protein 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGAP29 (AAH93767.1, 12 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9411

Enviar uma mensagem


ARHGAP29 polyclonal antibody (A01)

ARHGAP29 polyclonal antibody (A01)