SEP15 polyclonal antibody (A01)
  • SEP15 polyclonal antibody (A01)

SEP15 polyclonal antibody (A01)

Ref: AB-H00009403-A01
SEP15 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEP15.
Información adicional
Size 50 uL
Gene Name SEP15
Gene Alias -
Gene Description 15 kDa selenoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEP15 (NP_004252, 97 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9403

Enviar uma mensagem


SEP15 polyclonal antibody (A01)

SEP15 polyclonal antibody (A01)