GRAP2 monoclonal antibody (M01), clone 1G12
  • GRAP2 monoclonal antibody (M01), clone 1G12

GRAP2 monoclonal antibody (M01), clone 1G12

Ref: AB-H00009402-M01
GRAP2 monoclonal antibody (M01), clone 1G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRAP2.
Información adicional
Size 100 ug
Gene Name GRAP2
Gene Alias GADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38
Gene Description GRB2-related adaptor protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9402
Clone Number 1G12
Iso type IgG2a Kappa

Enviar uma mensagem


GRAP2 monoclonal antibody (M01), clone 1G12

GRAP2 monoclonal antibody (M01), clone 1G12