GRAP2 purified MaxPab mouse polyclonal antibody (B01P)
  • GRAP2 purified MaxPab mouse polyclonal antibody (B01P)

GRAP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009402-B01P
GRAP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GRAP2 protein.
Información adicional
Size 50 ug
Gene Name GRAP2
Gene Alias GADS|GRAP-2|GRB2L|GRBLG|GRID|GRPL|GrbX|Grf40|Mona|P38
Gene Description GRB2-related adaptor protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GRAP2 (NP_004801.1, 1 a.a. ~ 330 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9402

Enviar uma mensagem


GRAP2 purified MaxPab mouse polyclonal antibody (B01P)

GRAP2 purified MaxPab mouse polyclonal antibody (B01P)