STOML1 polyclonal antibody (A01)
  • STOML1 polyclonal antibody (A01)

STOML1 polyclonal antibody (A01)

Ref: AB-H00009399-A01
STOML1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STOML1.
Información adicional
Size 50 uL
Gene Name STOML1
Gene Alias FLJ36370|SLP-1|STORP|hUNC-24
Gene Description stomatin (EPB72)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STOML1 (NP_004800, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9399

Enviar uma mensagem


STOML1 polyclonal antibody (A01)

STOML1 polyclonal antibody (A01)