NRXN1 monoclonal antibody (M02), clone 4F7
  • NRXN1 monoclonal antibody (M02), clone 4F7

NRXN1 monoclonal antibody (M02), clone 4F7

Ref: AB-H00009378-M02
NRXN1 monoclonal antibody (M02), clone 4F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NRXN1.
Información adicional
Size 100 ug
Gene Name NRXN1
Gene Alias DKFZp313P2036|FLJ35941|Hs.22998|KIAA0578
Gene Description neurexin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRXN1 (NP_004792, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9378
Clone Number 4F7
Iso type IgG2b Kappa

Enviar uma mensagem


NRXN1 monoclonal antibody (M02), clone 4F7

NRXN1 monoclonal antibody (M02), clone 4F7