NRXN1 polyclonal antibody (A01)
  • NRXN1 polyclonal antibody (A01)

NRXN1 polyclonal antibody (A01)

Ref: AB-H00009378-A01
NRXN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRXN1.
Información adicional
Size 50 uL
Gene Name NRXN1
Gene Alias DKFZp313P2036|FLJ35941|Hs.22998|KIAA0578
Gene Description neurexin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRXN1 (NP_004792, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9378

Enviar uma mensagem


NRXN1 polyclonal antibody (A01)

NRXN1 polyclonal antibody (A01)