SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)

SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009376-B01P
SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC22A8 protein.
Información adicional
Size 50 ug
Gene Name SLC22A8
Gene Alias MGC24086|OAT3
Gene Description solute carrier family 22 (organic anion transporter), member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC22A8 (NP_004245.2, 1 a.a. ~ 542 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9376

Enviar uma mensagem


SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)

SLC22A8 purified MaxPab mouse polyclonal antibody (B01P)