TM9SF2 polyclonal antibody (A01)
  • TM9SF2 polyclonal antibody (A01)

TM9SF2 polyclonal antibody (A01)

Ref: AB-H00009375-A01
TM9SF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TM9SF2.
Información adicional
Size 50 uL
Gene Name TM9SF2
Gene Alias FLJ26287|MGC117391|P76
Gene Description transmembrane 9 superfamily member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVDIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TM9SF2 (NP_004791, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9375

Enviar uma mensagem


TM9SF2 polyclonal antibody (A01)

TM9SF2 polyclonal antibody (A01)