PPT2 polyclonal antibody (A01)
  • PPT2 polyclonal antibody (A01)

PPT2 polyclonal antibody (A01)

Ref: AB-H00009374-A01
PPT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPT2.
Información adicional
Size 50 uL
Gene Name PPT2
Gene Alias C6orf8|DKFZp564P1516|G14
Gene Description palmitoyl-protein thioesterase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPT2 (NP_005146, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9374

Enviar uma mensagem


PPT2 polyclonal antibody (A01)

PPT2 polyclonal antibody (A01)