PLAA monoclonal antibody (M04), clone 1F7
  • PLAA monoclonal antibody (M04), clone 1F7

PLAA monoclonal antibody (M04), clone 1F7

Ref: AB-H00009373-M04
PLAA monoclonal antibody (M04), clone 1F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLAA.
Información adicional
Size 100 ug
Gene Name PLAA
Gene Alias DOA1|FLJ11281|FLJ12699|PLA2P|PLAP
Gene Description phospholipase A2-activating protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAA (NP_004244, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9373
Clone Number 1F7
Iso type IgG2b Lambda

Enviar uma mensagem


PLAA monoclonal antibody (M04), clone 1F7

PLAA monoclonal antibody (M04), clone 1F7