KIF3B purified MaxPab mouse polyclonal antibody (B01P)
  • KIF3B purified MaxPab mouse polyclonal antibody (B01P)

KIF3B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009371-B01P
KIF3B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIF3B protein.
Información adicional
Size 50 ug
Gene Name KIF3B
Gene Alias HH0048|KIAA0359
Gene Description kinesin family member 3B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIF3B (ENSP00000364864, 1 a.a. ~ 747 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9371

Enviar uma mensagem


KIF3B purified MaxPab mouse polyclonal antibody (B01P)

KIF3B purified MaxPab mouse polyclonal antibody (B01P)