RAB28 purified MaxPab mouse polyclonal antibody (B03P)
  • RAB28 purified MaxPab mouse polyclonal antibody (B03P)

RAB28 purified MaxPab mouse polyclonal antibody (B03P)

Ref: AB-H00009364-B03P
RAB28 purified MaxPab mouse polyclonal antibody (B03P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAB28 protein.
Información adicional
Size 50 ug
Gene Name RAB28
Gene Alias MGC41862
Gene Description RAB28, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSDSEEESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQLIWSICEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB28 (AAH18067, 1 a.a. ~ 95 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.2
Gene ID 9364

Enviar uma mensagem


RAB28 purified MaxPab mouse polyclonal antibody (B03P)

RAB28 purified MaxPab mouse polyclonal antibody (B03P)