LONP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • LONP1 purified MaxPab rabbit polyclonal antibody (D01P)

LONP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009361-D01P
LONP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LONP1 protein.
Información adicional
Size 100 ug
Gene Name LONP1
Gene Alias LON|LONP|LonHS|MGC1498|PIM1|PRSS15|hLON
Gene Description lon peptidase 1, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGQRTCDASPPWALWGRGPAIGGQWRGFWEASSRGGGAFSGGEDASEGGAEEGAGGAGGSAGAGEGPVITALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSKRGKKEAEDELSARHP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LONP1 (NP_004784.2, 1 a.a. ~ 959 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9361

Enviar uma mensagem


LONP1 purified MaxPab rabbit polyclonal antibody (D01P)

LONP1 purified MaxPab rabbit polyclonal antibody (D01P)