LHX2 polyclonal antibody (A01)
  • LHX2 polyclonal antibody (A01)

LHX2 polyclonal antibody (A01)

Ref: AB-H00009355-A01
LHX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LHX2.
Información adicional
Size 50 uL
Gene Name LHX2
Gene Alias LH2|MGC138390|hLhx2
Gene Description LIM homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX2 (NP_004780, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9355

Enviar uma mensagem


LHX2 polyclonal antibody (A01)

LHX2 polyclonal antibody (A01)