UBE4A monoclonal antibody (M08), clone 1G8
  • UBE4A monoclonal antibody (M08), clone 1G8

UBE4A monoclonal antibody (M08), clone 1G8

Ref: AB-H00009354-M08
UBE4A monoclonal antibody (M08), clone 1G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE4A.
Información adicional
Size 100 ug
Gene Name UBE4A
Gene Alias E4|KIAA0126|MGC133315|UBOX2|UFD2
Gene Description ubiquitination factor E4A (UFD2 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE4A (NP_004779, 974 a.a. ~ 1073 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9354
Clone Number 1G8
Iso type IgG2a Kappa

Enviar uma mensagem


UBE4A monoclonal antibody (M08), clone 1G8

UBE4A monoclonal antibody (M08), clone 1G8