SLIT2 polyclonal antibody (A01)
  • SLIT2 polyclonal antibody (A01)

SLIT2 polyclonal antibody (A01)

Ref: AB-H00009353-A01
SLIT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLIT2.
Información adicional
Size 50 uL
Gene Name SLIT2
Gene Alias FLJ14420|SLIL3|Slit-2
Gene Description slit homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLIT2 (NP_004778, 1361 a.a. ~ 1460 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9353

Enviar uma mensagem


SLIT2 polyclonal antibody (A01)

SLIT2 polyclonal antibody (A01)